Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRA1 Rabbit Polyclonal Antibody (HRP)

ADGRA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GPR123

UniProt

Q86SQ6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR123

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YHIPSSLDGSPRSSRTDSPPSSLDGPAGTHTLACCTQGDPFPMVTQPEGS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNRD1 (Zinc Ribbon Domain Containing Protein 1) ELISA Kit
EH25836 96 Tests

Human ZNRD1 (Zinc Ribbon Domain Containing Protein 1) ELISA Kit

Sign In for Pricing
View Details
Porcine ECE1 (Endothelin Converting Enzyme 1) ValidElisa Kit
EK344840 96 Well

Porcine ECE1 (Endothelin Converting Enzyme 1) ValidElisa Kit

Sign In for Pricing
View Details
Mmu-miR-6932-3p inhibitor
HY-RI03586-01 5 nmol

Mmu-miR-6932-3p inhibitor

Sign In for Pricing
View Details
Mmu-miR-6932-3p inhibitor
HY-RI03586-02 20 nmol

Mmu-miR-6932-3p inhibitor

Sign In for Pricing
View Details
Histone H2B (mono methyl K5) Rabbit Polyclonal Antibody (RBITC)
orb1070068 100 µL

Histone H2B (mono methyl K5) Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Recombinant Anti-LYPD3 Rabbit mAb
MBS8326262-01 0.03 mL

Recombinant Anti-LYPD3 Rabbit mAb

Sign In for Pricing
View Details