Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HHIPL1 Rabbit Polyclonal Antibody (FITC)

HHIPL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

UNQ9245, KIAA1822

UniProt

Q96JK4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HHIPL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EFGQGGSLPILLDDVRCAGWERNLLECQHNGVGTHNCEHDEDAGVVCSHQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001120730

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acvr1c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3671808 1.0 µg DNA

Acvr1c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
PKC βII (F-7) Alexa Fluor® 488
sc-13149 AF488 200 µg/mL

PKC βII (F-7) Alexa Fluor® 488

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CYP76C3 Polyclonal Antibody
MBS7182340 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CYP76C3 Polyclonal Antibody

Sign In for Pricing
View Details
Human Aquaporin 0, AQP-0 ELISA Kit
MBS7253864-01 48 Well

Human Aquaporin 0, AQP-0 ELISA Kit

Sign In for Pricing
View Details
Human Aquaporin 0, AQP-0 ELISA Kit
MBS7253864-02 96 Well

Human Aquaporin 0, AQP-0 ELISA Kit

Sign In for Pricing
View Details
Human Aquaporin 0, AQP-0 ELISA Kit
MBS7253864-03 5x 96 Well

Human Aquaporin 0, AQP-0 ELISA Kit

Sign In for Pricing
View Details