Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LCOR Rabbit Polyclonal Antibody (Biotin)

LCOR Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MLR2, C10orf12

UniProt

Q96JN0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LCOR

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EGDPGSKQPRKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115816

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP57L1P1 ORF Vector (Human) (pORF)
ORF017267 1.0 µg DNA

CEP57L1P1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human EIF2AK1 Protein, N-His
HP961012-01 50 µg

Recombinant Human EIF2AK1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human EIF2AK1 Protein, N-His
HP961012-02 100 µg

Recombinant Human EIF2AK1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human EIF2AK1 Protein, N-His
HP961012-03 1 mg

Recombinant Human EIF2AK1 Protein, N-His

Sign In for Pricing
View Details
CYP3A5, CT (Cytochrome P450 3A5, CYPIIIA5, Cytochrome P450-PCN3, Cytochrome P450 HLp2) (APC)
MBS6471537-01 0.2 mL

CYP3A5, CT (Cytochrome P450 3A5, CYPIIIA5, Cytochrome P450-PCN3, Cytochrome P450 HLp2) (APC)

Sign In for Pricing
View Details
CYP3A5, CT (Cytochrome P450 3A5, CYPIIIA5, Cytochrome P450-PCN3, Cytochrome P450 HLp2) (APC)
MBS6471537-02 5x 0.2 mL

CYP3A5, CT (Cytochrome P450 3A5, CYPIIIA5, Cytochrome P450-PCN3, Cytochrome P450 HLp2) (APC)

Sign In for Pricing
View Details