Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHYHIPL Rabbit Polyclonal Antibody (HRP)

PHYHIPL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIAA1796

UniProt

Q96FC7

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PHYHIPL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QDVILEVIYTDPVDLSVGTVAEITGHQLMSLSTANAKKDPSCKTCNISVG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115815

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttll3 siRNA Oligos set (Rat)
48728176 3x 5 nmol

Ttll3 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
PCMV-ILK-3xHA-Neo Plasmid
PVT83987 2 µg

PCMV-ILK-3xHA-Neo Plasmid

Sign In for Pricing
View Details
DDX11L6 Protein Vector (Human) (pPM-C-HA)
PV072483 500 ng

DDX11L6 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
GNAI2, NT (GNAI2, GNAI2B, Guanine nucleotide-binding protein G(i) subunit alpha-2, Adenylate cyclase-inhibiting G alpha protein) (MaxLight 405)
MBS6302902-01 0.1 mL

GNAI2, NT (GNAI2, GNAI2B, Guanine nucleotide-binding protein G(i) subunit alpha-2, Adenylate cyclase-inhibiting G alpha protein) (MaxLight 405)

Sign In for Pricing
View Details
GNAI2, NT (GNAI2, GNAI2B, Guanine nucleotide-binding protein G(i) subunit alpha-2, Adenylate cyclase-inhibiting G alpha protein) (MaxLight 405)
MBS6302902-02 5x 0.1 mL

GNAI2, NT (GNAI2, GNAI2B, Guanine nucleotide-binding protein G(i) subunit alpha-2, Adenylate cyclase-inhibiting G alpha protein) (MaxLight 405)

Sign In for Pricing
View Details
Mouse Monoclonal CEA Antibody (PARLAM 4) [HRP]
NBP1-97718H 0.1 mL

Mouse Monoclonal CEA Antibody (PARLAM 4) [HRP]

Sign In for Pricing
View Details