Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD12 Rabbit Polyclonal Antibody (HRP)

BTBD12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FANCP, BTBD12, MUS312

UniProt

Q8IY92

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BTBD12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TKTLQGPAEKKPPSGSQAPRTKKQRVTKWQASEPAHSVNGEGGVLASAPD

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

200kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_115820

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Erythroid Transcription Factor (GATA1) Mouse ELISA Kit
D2447 96 Tests

Erythroid Transcription Factor (GATA1) Mouse ELISA Kit

Sign In for Pricing
View Details
TNFSF10 (Tumor Necrosis Factor Ligand Superfamily Member 10, Apo-2 Ligand, Apo-2L, APO2L, CD253, TNF-related Apoptosis-inducing Ligand, Protein TRAIL, TRAIL, TL2) APC
MBS6396732-01 0.1 mL

TNFSF10 (Tumor Necrosis Factor Ligand Superfamily Member 10, Apo-2 Ligand, Apo-2L, APO2L, CD253, TNF-related Apoptosis-inducing Ligand, Protein TRAIL, TRAIL, TL2) APC

Sign In for Pricing
View Details
TNFSF10 (Tumor Necrosis Factor Ligand Superfamily Member 10, Apo-2 Ligand, Apo-2L, APO2L, CD253, TNF-related Apoptosis-inducing Ligand, Protein TRAIL, TRAIL, TL2) APC
MBS6396732-02 5x 0.1 mL

TNFSF10 (Tumor Necrosis Factor Ligand Superfamily Member 10, Apo-2 Ligand, Apo-2L, APO2L, CD253, TNF-related Apoptosis-inducing Ligand, Protein TRAIL, TRAIL, TL2) APC

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Co-chaperone protein hscB (hscB)
MBS1281636-01 0.02 mg (E-Coli)

Recombinant Shigella dysenteriae serotype 1 Co-chaperone protein hscB (hscB)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Co-chaperone protein hscB (hscB)
MBS1281636-02 0.1 mg (E-Coli)

Recombinant Shigella dysenteriae serotype 1 Co-chaperone protein hscB (hscB)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Co-chaperone protein hscB (hscB)
MBS1281636-03 0.02 mg (Yeast)

Recombinant Shigella dysenteriae serotype 1 Co-chaperone protein hscB (hscB)

Sign In for Pricing
View Details