Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM185A Rabbit Polyclonal Antibody (FITC)

TMEM185A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ee3, FRAXF, FAM11A, CXorf13

UniProt

Q8NFB2

Immunogen

The immunogen for Anti-TMEM185A antibody is: synthetic peptide directed towards the N-terminal region of Human T185A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RNPQYRAEGETCVEFKAMLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVF

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115897.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSLN Human Monoclonal Antibody (APC)
orb2972663-01 50 Tests

MSLN Human Monoclonal Antibody (APC)

Sign In for Pricing
View Details
MSLN Human Monoclonal Antibody (APC)
orb2972663-02 100 Tests

MSLN Human Monoclonal Antibody (APC)

Sign In for Pricing
View Details
Ttc5-set siRNA/shRNA/RNAi Lentivector (Mouse)
48704094 4x 500 ng

Ttc5-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Rabbit Monoclonal PPIL1 Antibody (003) [PerCP]
NBP2-90270PCP 0.1 mL

Rabbit Monoclonal PPIL1 Antibody (003) [PerCP]

Sign In for Pricing
View Details
Rabbit Monoclonal BOLA1 Antibody (016) [mFluor Violet 610 SE]
NBP2-90236MFV610 0.1 mL

Rabbit Monoclonal BOLA1 Antibody (016) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Compound NP-019564
T129096-01 10 mg

Compound NP-019564

Sign In for Pricing
View Details