Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBAG9 Rabbit Polyclonal Antibody (HRP)

EBAG9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EB9, PDAF

UniProt

O00559

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human EBAG9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004206

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CREB Regulated Transcription Coactivator 3 (CRTC3) ELISA Kit
DLR-CRTC3-Hu-01 48 Tests

Human CREB Regulated Transcription Coactivator 3 (CRTC3) ELISA Kit

Sign In for Pricing
View Details
Human CREB Regulated Transcription Coactivator 3 (CRTC3) ELISA Kit
DLR-CRTC3-Hu-02 96 Tests

Human CREB Regulated Transcription Coactivator 3 (CRTC3) ELISA Kit

Sign In for Pricing
View Details
Mouse Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2) ELISA Kit
MBS7207907-01 48 Well

Mouse Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2) ELISA Kit

Sign In for Pricing
View Details
Mouse Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2) ELISA Kit
MBS7207907-02 96 Well

Mouse Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2) ELISA Kit

Sign In for Pricing
View Details
Mouse Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2) ELISA Kit
MBS7207907-03 5x 96 Well

Mouse Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2) ELISA Kit

Sign In for Pricing
View Details
Mouse Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2) ELISA Kit
MBS7207907-04 10x 96 Well

Mouse Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2) ELISA Kit

Sign In for Pricing
View Details