NFYA, Human
The NFYA protein is a component of the NF-Y transcription factor and recognizes the 5'-CCAAT-3' box motif in gene promoters. NFYA functions as an activator or repressor depending on the interacting cofactors. NFYA Protein, Human is the recombinant human-derived NFYA protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
NFYA Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/nfya-protein-human.html
Smiles
MEQYTANSNSSTEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS
Molecular Formula
4800 (Gene_ID) P23511-2 (M1-S318) (Accession)
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CDCA8 Mouse Monoclonal Antibody [Clone ID: OTI2D8]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
GTR15196015 1 Vial
Lentiviral mouse Pde4a shRNA (UAS) - Lentiviral mouse Pde4a shRNA (UAS) plasmid
Sign In for Pricing
View Details 
HK207470 1 Kit
TropomodULin 1 (TMOD1) Human qPCR Template Standard (NM_003275)
Sign In for Pricing
View Details LV751841 1.0 µg DNA
TRNAF4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details