Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFYA, Human

The NFYA protein is a component of the NF-Y transcription factor and recognizes the 5'-CCAAT-3' box motif in gene promoters. NFYA functions as an activator or repressor depending on the interacting cofactors. NFYA Protein, Human is the recombinant human-derived NFYA protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

NFYA Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nfya-protein-human.html

Smiles

MEQYTANSNSSTEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS

Molecular Formula

4800 (Gene_ID) P23511-2 (M1-S318) (Accession)

Molecular Weight

Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Hsa-miR-4779 miRNA Antagomir
CIJ1671-01 10 nmol

Hsa-miR-4779 miRNA Antagomir

Ask
View Details
Hsa-miR-4779 miRNA Antagomir
CIJ1671-02 20 nmol

Hsa-miR-4779 miRNA Antagomir

Ask
View Details
Lentiviral human SNAPC2 shRNA (UAS) - Lentiviral human SNAPC2 shRNA (UAS, iRFP) (100)
GTR15085431 1 Vial

Lentiviral human SNAPC2 shRNA (UAS) - Lentiviral human SNAPC2 shRNA (UAS, iRFP) (100)

Ask
View Details
Trim42 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
47785116 3x 1.0 µg

Trim42 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Ask
View Details
ApoM (Apolipoprotein M) BioAssayTM ELISA Kit (Porcine) discontinued
354053-01 48 Tests

ApoM (Apolipoprotein M) BioAssayTM ELISA Kit (Porcine) discontinued

Ask
View Details
ApoM (Apolipoprotein M) BioAssayTM ELISA Kit (Porcine) discontinued
354053-02 96 Tests

ApoM (Apolipoprotein M) BioAssayTM ELISA Kit (Porcine) discontinued

Ask
View Details