NFYA, Human
The NFYA protein is a component of the NF-Y transcription factor and recognizes the 5'-CCAAT-3' box motif in gene promoters. NFYA functions as an activator or repressor depending on the interacting cofactors. NFYA Protein, Human is the recombinant human-derived NFYA protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
NFYA Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/nfya-protein-human.html
Smiles
MEQYTANSNSSTEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS
Molecular Formula
4800 (Gene_ID) P23511-2 (M1-S318) (Accession)
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
140750 200 µL
EPAS1 (Endothelial PAS Domain-containing Protein 1, EPAS-1, Basic-helix-loop-helix-PAS Protein MOP2, Class E Basic Helix-loop-helix Protein 73, bHLHe73, HIF-1-alpha-like Factor, HLF, Hypoxia-inducible Factor 2-alpha, HIF-2-alpha, HIF2-alpha, Member of PAS Protein 2, PAS Domain-containing Protein 2, BHLHE73, HIF2A, MOP2, PASD2)
Sign In for Pricing
View Details 