Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGSF8 Rabbit Polyclonal Antibody (HRP)

IGSF8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EWI2, PGRL, CD316, EWI-2, KCT-4, CD81P3, LIR-D1

UniProt

Q969P0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IGSF8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEW

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_443100

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPR1 ORF Vector (Human) (pORF)
ORF026233 1.0 µg DNA

NPR1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal CD4 Antibody (1033236) [Allophycocyanin]
FAB37913A 0.1 mL

Mouse Monoclonal CD4 Antibody (1033236) [Allophycocyanin]

Sign In for Pricing
View Details
Mouse Secreted frizzled-related protein 5 (SFRP5) ELISA Kit
EK7356 48 Tests

Mouse Secreted frizzled-related protein 5 (SFRP5) ELISA Kit

Sign In for Pricing
View Details
Mouse Kif2b activation kit by CRISPRa
GA209511 1 Kit

Mouse Kif2b activation kit by CRISPRa

Sign In for Pricing
View Details
CX3CR1 (B-7) Alexa Fluor® 647
sc-377227 AF647 200 µg/mL

CX3CR1 (B-7) Alexa Fluor® 647

Sign In for Pricing
View Details
8 cap strip, PCR, polypropylene, flat top, for 652201, -60, -70, - 90,6732xx, 125 pieces per ZP1
373250 125 pieces per ZP1

8 cap strip, PCR, polypropylene, flat top, for 652201, -60, -70, - 90,6732xx, 125 pieces per ZP1

Sign In for Pricing
View Details