Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cd248 Rabbit Polyclonal Antibody (HRP)

Cd248 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Tem1, Cd164l, Cd164l1, AI842296, 2610111G01Rik

UniProt

Q91V98

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Cd248

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DGAVSCRCSEGFRLAADGHSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGF

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_473383

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIAE Polyclonal Antibody
ANT-14388-100ug 100 µg

SIAE Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse BET3L Protein, His (Fc)-Avi-tagged
BET3L-1017M 50 µg

Recombinant Mouse BET3L Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Rabbit Polyclonal KLRA1 Antibody
NBP1-76983-0.025mg 0.025 mg

Rabbit Polyclonal KLRA1 Antibody

Sign In for Pricing
View Details
UBC13 HDR Plasmid (h)
sc-417204-HDR 20 µg

UBC13 HDR Plasmid (h)

Sign In for Pricing
View Details
Prkce 3'UTR GFP Stable Cell Line
TU166953 1.0 mL

Prkce 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PSMD8 Rabbit Polyclonal Antibody (Fluoro550)
orb3094516 100 µg

PSMD8 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details