Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cd248 Rabbit Polyclonal Antibody (HRP)

Cd248 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Tem1, Cd164l, Cd164l1, AI842296, 2610111G01Rik

UniProt

Q91V98

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Cd248

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DGAVSCRCSEGFRLAADGHSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGF

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_473383

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR2 Human shRNA Lentiviral Particle (Locus ID 7097)
TL320553V 500 µL Each

TLR2 Human shRNA Lentiviral Particle (Locus ID 7097)

Sign In for Pricing
View Details
FITC Anti-Human CD66b Antibody
RD30487F-01 20 Tests

FITC Anti-Human CD66b Antibody

Sign In for Pricing
View Details
FITC Anti-Human CD66b Antibody
RD30487F-02 100 Tests

FITC Anti-Human CD66b Antibody

Sign In for Pricing
View Details
FITC Anti-Human CD66b Antibody
RD30487F-03 2x 100 Tests

FITC Anti-Human CD66b Antibody

Sign In for Pricing
View Details
EPOP Human Gene Knockout Kit (CRISPR)
KN425579 1 Kit

EPOP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Polyclonal FUS Antibody
APR00190G 0.1ml

Polyclonal FUS Antibody

Sign In for Pricing
View Details