Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGI3 Rabbit Polyclonal Antibody (HRP)

LGI3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LGIL4

UniProt

Q8N145

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LGI3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GNSLNCDCKVKWLVEWLAHTNTTVAPIYCASPPRFQEHKVQDLPLREFDC

Field of Research

Neuroscience

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_644807.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bismuth Citrate
TRC-B497270-10G 10 g

Bismuth Citrate

Sign In for Pricing
View Details
Mouse Coxsackievirus And Adenovirus Receptor Homolog (CXADR) Protein
abx657568-01 50 µg

Mouse Coxsackievirus And Adenovirus Receptor Homolog (CXADR) Protein

Sign In for Pricing
View Details
Mouse Coxsackievirus And Adenovirus Receptor Homolog (CXADR) Protein
abx657568-02 100 µg

Mouse Coxsackievirus And Adenovirus Receptor Homolog (CXADR) Protein

Sign In for Pricing
View Details
Mouse Coxsackievirus And Adenovirus Receptor Homolog (CXADR) Protein
abx657568-03 200 µg

Mouse Coxsackievirus And Adenovirus Receptor Homolog (CXADR) Protein

Sign In for Pricing
View Details
Mouse Coxsackievirus And Adenovirus Receptor Homolog (CXADR) Protein
abx657568-04 500 µg

Mouse Coxsackievirus And Adenovirus Receptor Homolog (CXADR) Protein

Sign In for Pricing
View Details
Mouse Coxsackievirus And Adenovirus Receptor Homolog (CXADR) Protein
abx657568-05 1 mg

Mouse Coxsackievirus And Adenovirus Receptor Homolog (CXADR) Protein

Sign In for Pricing
View Details