Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRGPRF Rabbit Polyclonal Antibody (Biotin)

MRGPRF Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RTA, mrgF, GPR140, GPR168

UniProt

Q96AM1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MRGPRF

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_659452

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ivabradine Nitroso Impurity 1
CS-EO-03201 1 Each

Ivabradine Nitroso Impurity 1

Sign In for Pricing
View Details
ERMIN, ID (ERMN, KIAA1189, Ermin, Juxtanodin) (MaxLight 650) discontinued
035213-ML650 100 µL

ERMIN, ID (ERMN, KIAA1189, Ermin, Juxtanodin) (MaxLight 650) discontinued

Sign In for Pricing
View Details
ZNF607, ID (ZNF607, Zinc finger protein 607) (MaxLight 750)
MBS6367194-01 0.1 mL

ZNF607, ID (ZNF607, Zinc finger protein 607) (MaxLight 750)

Sign In for Pricing
View Details
ZNF607, ID (ZNF607, Zinc finger protein 607) (MaxLight 750)
MBS6367194-02 5x 0.1 mL

ZNF607, ID (ZNF607, Zinc finger protein 607) (MaxLight 750)

Sign In for Pricing
View Details
Rabbit Anti-Human RUBCN pAb
PA10358-01 50 μL

Rabbit Anti-Human RUBCN pAb

Sign In for Pricing
View Details
Rabbit Anti-Human RUBCN pAb
PA10358-02 100 μL

Rabbit Anti-Human RUBCN pAb

Sign In for Pricing
View Details