Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADORA2B Rabbit Polyclonal Antibody (FITC)

ADORA2B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ADORA2

UniProt

P29275

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ADORA2B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHAN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_000667

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta Defensin 2, Human, BioAssayTM ELISA Kit (beta Defensin-2, beta 2 Defensin, Defensin beta 2, BD 2, BD-2, DEFB2, DEFB-2, HBD 2, HBD2, HBD-2, DEFB102, Skin Antimicrobial Peptide 1, SAP1, BD2)
B0901-16 96 Tests

Beta Defensin 2, Human, BioAssayTM ELISA Kit (beta Defensin-2, beta 2 Defensin, Defensin beta 2, BD 2, BD-2, DEFB2, DEFB-2, HBD 2, HBD2, HBD-2, DEFB102, Skin Antimicrobial Peptide 1, SAP1, BD2)

Sign In for Pricing
View Details
α-protein Kinase 1 Antibody
OM636476-01 100 µL

α-protein Kinase 1 Antibody

Sign In for Pricing
View Details
α-protein Kinase 1 Antibody
OM636476-02 20 µL

α-protein Kinase 1 Antibody

Sign In for Pricing
View Details
α-protein Kinase 1 Antibody
OM636476-03 50 µL

α-protein Kinase 1 Antibody

Sign In for Pricing
View Details
TBC14, ID (TBC1D14, KIAA1322, TBC1 domain family member 14) (PE) discontinued
042625-PE 200 µL

TBC14, ID (TBC1D14, KIAA1322, TBC1 domain family member 14) (PE) discontinued

Sign In for Pricing
View Details
FCGR3A Antibody (C-term)
MBS9215097-01 0.08 mL

FCGR3A Antibody (C-term)

Sign In for Pricing
View Details