Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CMA1 Rabbit Polyclonal Antibody (HRP)

CMA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CYH, MCT1, chymase

UniProt

P23946

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CMA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_001827

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat HSPD1 Protein, N-His
orb2963378-01 50 µg

Recombinant Rat HSPD1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Rat HSPD1 Protein, N-His
orb2963378-02 100 µg

Recombinant Rat HSPD1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Rat HSPD1 Protein, N-His
orb2963378-03 1 mg

Recombinant Rat HSPD1 Protein, N-His

Sign In for Pricing
View Details
SUMO2 (Small Ubiquitin-related Modifier 2, SUMO-2, HSMT3, SMT3 Homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A, Smt3A, SMT3A, SMT3H2) (MaxLight 650)
134090-ML650 100 µL

SUMO2 (Small Ubiquitin-related Modifier 2, SUMO-2, HSMT3, SMT3 Homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A, Smt3A, SMT3A, SMT3H2) (MaxLight 650)

Sign In for Pricing
View Details
Hsa-miR-125b-2-3p miRNA Antagomir
CIJ0546-01 10 nmol

Hsa-miR-125b-2-3p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-125b-2-3p miRNA Antagomir
CIJ0546-02 20 nmol

Hsa-miR-125b-2-3p miRNA Antagomir

Sign In for Pricing
View Details