Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNN3 Rabbit Polyclonal Antibody (HRP)

CNN3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q15417

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CNN3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGE

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001830

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCHE antibody
10R-3422 100 µL

BCHE antibody

Sign In for Pricing
View Details
RNF24, ID (RNF24, RING finger protein 24) (MaxLight 550)
MBS6342881-01 0.1 mL

RNF24, ID (RNF24, RING finger protein 24) (MaxLight 550)

Sign In for Pricing
View Details
RNF24, ID (RNF24, RING finger protein 24) (MaxLight 550)
MBS6342881-02 5x 0.1 mL

RNF24, ID (RNF24, RING finger protein 24) (MaxLight 550)

Sign In for Pricing
View Details
PE/iFluor® 700 Anti-cow/ human CD46 Antibody *MEM-258*
104601X0-AAT 25 Tests

PE/iFluor® 700 Anti-cow/ human CD46 Antibody *MEM-258*

Sign In for Pricing
View Details
MMP24 Adenovirus (Rat)
30249056 1.0 mL

MMP24 Adenovirus (Rat)

Sign In for Pricing
View Details
FAM35A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
20009111 3x 1.0 µg

FAM35A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details