Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Etfdh Rabbit Polyclonal Antibody (HRP)

Etfdh Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AV001013, 0610010I20Rik

UniProt

Q921G7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Etfdh

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EVLYHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAKVTVFAEGCHGH

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_080070

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, pan (AE-1 / AE-3), 0.2mg/mL
BNUB0371-100 1x 100 µL

Cytokeratin, pan (AE-1 / AE-3), 0.2mg/mL

Sign In for Pricing
View Details
XBP1 Mouse Monoclonal Antibody [Clone ID: OTI2E2]
CF815378 100 µg

XBP1 Mouse Monoclonal Antibody [Clone ID: OTI2E2]

Sign In for Pricing
View Details
EXOSC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C7]
TA808591AM 100 µL

EXOSC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C7]

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3230), CF568 conjugate, 0.1mg/mL
BNC683230-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3230), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon: sigmoid
CD563432 5 µg

Tissue Genomic DNA, Colon: sigmoid

Sign In for Pricing
View Details
LMO2 (B-Cell Marker) (rLMO2/1971), CF740 conjugate, 0.1mg/mL
BNC743806-100 1x 100 µL

LMO2 (B-Cell Marker) (rLMO2/1971), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details