Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fabp5 Rabbit Polyclonal Antibody (FITC)

Fabp5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Kl, ma, Klbp, mal1, Fabpe, E-FABP, PA-FABP

UniProt

Q05816

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034764

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human C4orf46 shRNA (UAS) - Lentiviral human C4orf46 shRNA (UAS, iRFP) (100)
GTR15308178 1 Vial

Lentiviral human C4orf46 shRNA (UAS) - Lentiviral human C4orf46 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Phospho-RAF1 (Ser338/Tyr340) Rabbit pAb, IRDye 800CW conjugated
orb2827760 100 µL

Phospho-RAF1 (Ser338/Tyr340) Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
EXOC3L1 (NM_178516) Human Over-expression Lysate
LS283849-100ug 100 µg

EXOC3L1 (NM_178516) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral mouse Trim32 shRNA (UAS) - Lentiviral mouse Trim32 shRNA (UAS, RFP) (25)
GTR15299138 1 Vial

Lentiviral mouse Trim32 shRNA (UAS) - Lentiviral mouse Trim32 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Sheep Tax1-Binding Protein 3 (TAX1BP3) ELISA Kit
MBS9938882-01 48 Well

Sheep Tax1-Binding Protein 3 (TAX1BP3) ELISA Kit

Sign In for Pricing
View Details
Sheep Tax1-Binding Protein 3 (TAX1BP3) ELISA Kit
MBS9938882-02 96 Well

Sheep Tax1-Binding Protein 3 (TAX1BP3) ELISA Kit

Sign In for Pricing
View Details