Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fabp5 Rabbit Polyclonal Antibody (HRP)

Fabp5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Kl, ma, Klbp, mal1, Fabpe, E-FABP, PA-FABP

UniProt

Q05816

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034764

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DNA ligase 1 ELISA Kit
MBS2883984-01 48 Well

Human DNA ligase 1 ELISA Kit

Sign In for Pricing
View Details
Human DNA ligase 1 ELISA Kit
MBS2883984-02 96 Well

Human DNA ligase 1 ELISA Kit

Sign In for Pricing
View Details
Human DNA ligase 1 ELISA Kit
MBS2883984-03 5x 96 Well

Human DNA ligase 1 ELISA Kit

Sign In for Pricing
View Details
Human DNA ligase 1 ELISA Kit
MBS2883984-04 10x 96 Well

Human DNA ligase 1 ELISA Kit

Sign In for Pricing
View Details
Vmn2r30 Protein Vector (Mouse) (pPB-C-His)
PV246158 500 ng

Vmn2r30 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
AGN 192870
T61588-01 1 mg

AGN 192870

Sign In for Pricing
View Details