Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QBP Rabbit Polyclonal Antibody (Biotin)

C1QBP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P32, HABP1, gC1qR, GC1QBP, SF2p32, gC1Q-R, COXPD33, SF2AP32

UniProt

Q07021

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C1QBP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESE

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001203.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD83 (B Cell activation protein, BL11, Cell Surface Protein HB15) (APC) discontinued
C2435-APC 200 µL

CD83 (B Cell activation protein, BL11, Cell Surface Protein HB15) (APC) discontinued

Sign In for Pricing
View Details
AGO4 Antibody
orb523656-01 50 μL

AGO4 Antibody

Sign In for Pricing
View Details
AGO4 Antibody
orb523656-02 100 µL

AGO4 Antibody

Sign In for Pricing
View Details
Table Top Spectrophotometer
LX300TS 1 Unit

Table Top Spectrophotometer

Sign In for Pricing
View Details
Akap10 3'UTR GFP Stable Cell Line
TU250448 1.0 mL

Akap10 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Equine NTF3 ELISA KIT (1 x 96 wells)
EA102816 96 Well

Equine NTF3 ELISA KIT (1 x 96 wells)

Sign In for Pricing
View Details