Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5AR1 Rabbit Polyclonal Antibody (HRP)

C5AR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C5A, C5AR, C5R1, CD88

UniProt

P21730

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C5AR1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLK

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001727

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclosporin C
TRC-C988905-50MG 50 mg

Cyclosporin C

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF568 conjugate, 0.1mg/mL
BNC681384-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Vinculin/VCL protein (His tag)
PDEH100977-01 20 µg

Recombinant Human Vinculin/VCL protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Vinculin/VCL protein (His tag)
PDEH100977-02 100 µg

Recombinant Human Vinculin/VCL protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Vinculin/VCL protein (His tag)
PDEH100977-03 500 µg

Recombinant Human Vinculin/VCL protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Vinculin/VCL protein (His tag)
PDEH100977-04 1 mg

Recombinant Human Vinculin/VCL protein (His tag)

Sign In for Pricing
View Details