Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNHIT2 Rabbit Polyclonal Antibody (FITC)

ZNHIT2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FON, C11orf5

UniProt

Q9UHR6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNHIT2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KGYTLAALGDLAQTLGRARKQAVAREERDHLYRARKKCQFLLAWTNENEA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_055020

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Apolipoprotein D (APOD) Antibody Pair Kit (with Standard)
MBS2101130-01 5x 96 Tests

Rat Apolipoprotein D (APOD) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Apolipoprotein D (APOD) Antibody Pair Kit (with Standard)
MBS2101130-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Apolipoprotein D (APOD) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Apolipoprotein D (APOD) Antibody Pair Kit (with Standard)
MBS2101130-03 10x 96 Tests

Rat Apolipoprotein D (APOD) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Apolipoprotein D (APOD) Antibody Pair Kit (with Standard)
MBS2101130-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rat Apolipoprotein D (APOD) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
MGC13096 (PDCD2L) Mouse Monoclonal Antibody [Clone ID: LBI4H10]
AMM20737VCF 100 µg

MGC13096 (PDCD2L) Mouse Monoclonal Antibody [Clone ID: LBI4H10]

Sign In for Pricing
View Details
GPR52 Antibody
orb1539246 50 μL

GPR52 Antibody

Sign In for Pricing
View Details