Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem50b Rabbit Polyclonal Antibody (HRP)

Tmem50b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AU015466, AU019872, B230114J08Rik

UniProt

Q9D1X9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PKPEQLNHAFHTCGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVW

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_084294

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Khk ELISA Kit
ELI-06492r 96 Tests

Rat Khk ELISA Kit

Sign In for Pricing
View Details
UHRF2 Antibody
E19-6930 100 µg -100 µL

UHRF2 Antibody

Sign In for Pricing
View Details
PIB5PA (INPP5J) (NM_001002837) Human Over-expression Lysate
LH03298V 100 µg

PIB5PA (INPP5J) (NM_001002837) Human Over-expression Lysate

Sign In for Pricing
View Details
Aquaporin 4 (AQP4, WCH4, MIWC, Mercury-insensitive Water Channel) discontinued
A3000-14A 100 µg

Aquaporin 4 (AQP4, WCH4, MIWC, Mercury-insensitive Water Channel) discontinued

Sign In for Pricing
View Details
Histone Deacetylase 3 (HDAC3) (MaxLight 750) discontinued
H5109-48D-ML750 100 µL

Histone Deacetylase 3 (HDAC3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MIRacle™ hsa-miR-6787-3p miRNA Agomir/Antagomir
AM1335 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-6787-3p miRNA Agomir/Antagomir

Sign In for Pricing
View Details