Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA2 Rabbit Polyclonal Antibody (HRP)

CA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAC, CAII, Car2, CA-II, HEL-76, HEL-S-282

UniProt

P00918

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000058

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-1941-5p miRNA Mimic
CMM0619-01 5 nmol

Mmu-miR-1941-5p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-1941-5p miRNA Mimic
CMM0619-02 10 nmol

Mmu-miR-1941-5p miRNA Mimic

Sign In for Pricing
View Details
E2F6 antibody
70R-16977 50 ul

E2F6 antibody

Sign In for Pricing
View Details
Rhodopsin, Blue (OPSD, Opsin 2, Opsin 2 Rod Pigment, Opsin-2, OPN2, Retinitis Pigmentosa 4, Retinitis Pigmentosa 4 Autosomal Dominant, RP4) (FITC)
R1998-17-FITC 100 µL

Rhodopsin, Blue (OPSD, Opsin 2, Opsin 2 Rod Pigment, Opsin-2, OPN2, Retinitis Pigmentosa 4, Retinitis Pigmentosa 4 Autosomal Dominant, RP4) (FITC)

Sign In for Pricing
View Details
CLCN5 CRISPR Knock Out 293T Cell Line (Human)
16255141 1x 10^6 Cells / 1.0 mL

CLCN5 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Ermp1 (NM_001081213) Mouse Tagged ORF Clone Lentiviral Particle
MR217644L4V 200 µL

Ermp1 (NM_001081213) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details