Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA2 Rabbit Polyclonal Antibody (HRP)

CA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAC, CAII, Car2, CA-II, HEL-76, HEL-S-282

UniProt

P00918

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000058

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MtRPOL Lentiviral Activation Particles (m2)
sc-432059-LAC-2 200 µL

MtRPOL Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Renin Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-6184R-BF405-01 20 µL

Renin Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Renin Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-6184R-BF405-02 100 µL

Renin Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Abcd2 (NM_033352) Rat Untagged Clone
RN207415 10 µg

Abcd2 (NM_033352) Rat Untagged Clone

Sign In for Pricing
View Details
KHDRBS3 Adenovirus (Human)
25507051 1.0 mL

KHDRBS3 Adenovirus (Human)

Sign In for Pricing
View Details
P53 S33 Rabbit Polyclonal Antibody
E53P05497 100 µL

P53 S33 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details