Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA5A Rabbit Polyclonal Antibody (HRP)

CA5A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CA5, CAV, CAVA, CA5AD, GS1-21A4.1

UniProt

P35218

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CA5A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_001730

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTH1 Rabbit Monoclonal Antibody
E10G21692 100 µL

MTH1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Caspase-4 Antibody [Allophycocyanin]
NBP2-97308APC 0.1 mL

Rabbit Polyclonal Caspase-4 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Lentiviral human ADGRF5 shRNA (UAS) - Lentiviral human ADGRF5 shRNA (UAS, RFP) plasmid
GTR15079369 1 Vial

Lentiviral human ADGRF5 shRNA (UAS) - Lentiviral human ADGRF5 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Phospho-RPS6KB1 (Thr421/Ser424) Recombinant Antibody, PE Conjugated
bsm-62970R-PE 100 µL

Phospho-RPS6KB1 (Thr421/Ser424) Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Hsd3b1 shRNA (UAS) - Lentiviral mouse Hsd3b1 shRNA (UAS, RFP) (25)
GTR15122867 1 Vial

Lentiviral mouse Hsd3b1 shRNA (UAS) - Lentiviral mouse Hsd3b1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
TSG-6 Rabbit Polyclonal Antibody
APRab19360-01 20 µL

TSG-6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details