Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA7 Rabbit Polyclonal Antibody (HRP)

CA7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAVII, CA-VII

UniProt

P43166

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CA7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005173

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGFC (Flt 4L, Flt4 Ligand, FLT4 Ligand DHM, Flt4-L, Flt4L, Vascular Endothelial Growth Factor C, Vascular Endothelial Growth Factor Related Protein, Vascular Endothelial Growth Factor-Related Protein, VEGF C, VEGF-C, Vegfc, VEGFC_HUMAN, VRP, )
226647 50 µL

VEGFC (Flt 4L, Flt4 Ligand, FLT4 Ligand DHM, Flt4-L, Flt4L, Vascular Endothelial Growth Factor C, Vascular Endothelial Growth Factor Related Protein, Vascular Endothelial Growth Factor-Related Protein, VEGF C, VEGF-C, Vegfc, VEGFC_HUMAN, VRP, )

Sign In for Pricing
View Details
IgG3 (Biotin) discontinued
I1904-85D-Biotin 100 µL

IgG3 (Biotin) discontinued

Sign In for Pricing
View Details
PPP1R12A Protein Vector (Human) (pPM-C-HA)
PV056551 500 ng

PPP1R12A Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
BRMS1 (Breast Cancer Metastasis-suppressor 1) (FITC)
124008-FITC 100 µL

BRMS1 (Breast Cancer Metastasis-suppressor 1) (FITC)

Sign In for Pricing
View Details
Porcine Gamma-Aminobutyric Acid Receptor Subunit Delta (GABRD) ELISA Kit
MBS9936345-01 48 Well

Porcine Gamma-Aminobutyric Acid Receptor Subunit Delta (GABRD) ELISA Kit

Sign In for Pricing
View Details
Porcine Gamma-Aminobutyric Acid Receptor Subunit Delta (GABRD) ELISA Kit
MBS9936345-02 96 Well

Porcine Gamma-Aminobutyric Acid Receptor Subunit Delta (GABRD) ELISA Kit

Sign In for Pricing
View Details