Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALB1 Rabbit Polyclonal Antibody (HRP)

CALB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CALB, D-28K

UniProt

P05937

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CALB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKAN

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004920.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gtf2ird1 Pre-designed siRNA Set B
SI105936B 1 Each

Mouse Gtf2ird1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human ALPP Protein, His Tag
orb1743334-01 10 µg

Human ALPP Protein, His Tag

Sign In for Pricing
View Details
Human ALPP Protein, His Tag
orb1743334-02 50 µg

Human ALPP Protein, His Tag

Sign In for Pricing
View Details
Human ALPP Protein, His Tag
orb1743334-03 100 µg

Human ALPP Protein, His Tag

Sign In for Pricing
View Details
ATPAF2 (ATP synthase Mitochondrial F1 complex assembly factor 2)
307162-01 50 µg

ATPAF2 (ATP synthase Mitochondrial F1 complex assembly factor 2)

Sign In for Pricing
View Details
ATPAF2 (ATP synthase Mitochondrial F1 complex assembly factor 2)
307162-02 100 µg

ATPAF2 (ATP synthase Mitochondrial F1 complex assembly factor 2)

Sign In for Pricing
View Details