Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH5 Rabbit Polyclonal Antibody (HRP)

CDH5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

7B4, CD144

UniProt

P33151

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLFVEDPDEPQNRMTKYSILRGDYQDAFTIETNPAHNEGIIKPMKPLDYE

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001786

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) PHM7 Polyclonal Antibody
MBS7190653 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) PHM7 Polyclonal Antibody

Sign In for Pricing
View Details
CD3E Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-60635R-BF647-01 20 µL

CD3E Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
CD3E Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-60635R-BF647-02 100 µL

CD3E Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Marveld1 shRNA (UAS) - Lentiviral mouse Marveld1 shRNA (UAS, iRFP) (25)
GTR15269342 1 Vial

Lentiviral mouse Marveld1 shRNA (UAS) - Lentiviral mouse Marveld1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Ataxin 1 (ATXN1) (NM_001128164) Human Tagged Lenti ORF Clone
RC226185L3 10 µg

Ataxin 1 (ATXN1) (NM_001128164) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
WDR40B Lentiviral Activation Particles (h)
sc-414462-LAC 200 µL

WDR40B Lentiviral Activation Particles (h)

Sign In for Pricing
View Details