Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP24A1 Rabbit Polyclonal Antibody (Biotin)

CYP24A1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CP24, HCAI, CYP24, HCINF1, P450-CC24

UniProt

Q07973

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CYP24A1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000773

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Anopheles gambiae Pescadillo homolog (AGAP007112), partial
MBS1426117 Inquire

Recombinant Anopheles gambiae Pescadillo homolog (AGAP007112), partial

Sign In for Pricing
View Details
Porcine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) ELISA Kit
MBS7213557-01 48 Well

Porcine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) ELISA Kit

Sign In for Pricing
View Details
Porcine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) ELISA Kit
MBS7213557-02 96 Well

Porcine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) ELISA Kit

Sign In for Pricing
View Details
Porcine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) ELISA Kit
MBS7213557-03 5x 96 Well

Porcine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) ELISA Kit

Sign In for Pricing
View Details
Porcine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) ELISA Kit
MBS7213557-04 10x 96 Well

Porcine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) ELISA Kit

Sign In for Pricing
View Details
Alpha Sarcoglycan Rabbit Monoclonal Antibody
E49Y6889 100 µL

Alpha Sarcoglycan Rabbit Monoclonal Antibody

Sign In for Pricing
View Details