Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP24A1 Rabbit Polyclonal Antibody (Biotin)

CYP24A1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CP24, HCAI, CYP24, HCINF1, P450-CC24

UniProt

Q07973

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CYP24A1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000773

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Mouse IgG Fc, FITC conjugated
orb868302-01 100 µL

Rabbit Anti-Mouse IgG Fc, FITC conjugated

Sign In for Pricing
View Details
Rabbit Anti-Mouse IgG Fc, FITC conjugated
orb868302-02 1 mL

Rabbit Anti-Mouse IgG Fc, FITC conjugated

Sign In for Pricing
View Details
Ras-Like protein family member 11B (RASL11B) Bovine ELISA Kit
G6433 96 Tests

Ras-Like protein family member 11B (RASL11B) Bovine ELISA Kit

Sign In for Pricing
View Details
DNAJC30 Antibody
OACA05694-50UG 50 µg

DNAJC30 Antibody

Sign In for Pricing
View Details
7-Dehydrocholesterol Reductase (DHCR7), Recombinant, Human, His-Tag, GST-Tag
054841-01 10 µg

7-Dehydrocholesterol Reductase (DHCR7), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
7-Dehydrocholesterol Reductase (DHCR7), Recombinant, Human, His-Tag, GST-Tag
054841-02 50 µg

7-Dehydrocholesterol Reductase (DHCR7), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details