Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP26A1 Rabbit Polyclonal Antibody (HRP)

CYP26A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CP26, CYP26, P450RAI, P450RAI1

UniProt

O43174

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CYP26A1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVIMRAFSREALECYVP

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COPG2 Human Gene Knockout Kit (CRISPR)
KN423372 1 Kit

COPG2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD81 Recombinant Monoclonal Mouse Antibody (2304.81), CF®405M Conjugate - Biotium Choice
P014-405M-500 1x 500 µL

CD81 Recombinant Monoclonal Mouse Antibody (2304.81), CF®405M Conjugate - Biotium Choice

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), CF594 conjugate, 0.1mg/mL
BNC941836-500 1x 500 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNFRSF1A Human Gene Knockout Kit (CRISPR)
KN204008 1 Kit

TNFRSF1A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 5/8 (C-50), CF488A conjugate, 0.1mg/mL
BNC880948-500 1x 500 µL

Cytokeratin 5/8 (C-50), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: left
CR562876 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details