Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP51A1 Rabbit Polyclonal Antibody (Biotin)

CYP51A1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LDM, CP51, CYP51, CYPL1, P450L1, P450-14DM

UniProt

Q16850

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CYP51A1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000777

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometriotic tissue
CS702971 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
NF-L Recombinant Chimeric Antibody Antibody
HA601409 100 µL

NF-L Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Accuris qMAX Green One-Step RT-qPCR Kit, High Rox, sample 20 reactions
PR2120-H-S 1 Each

Accuris qMAX Green One-Step RT-qPCR Kit, High Rox, sample 20 reactions

Sign In for Pricing
View Details
Nfe2l2 Mouse Gene Knockout Kit (CRISPR)
KN310937LP 1 Kit

Nfe2l2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse PTPN6/SH-PTP1 Protein (aa 207-597, His & GST Tag)
PKSM040450 100 µg

Recombinant Mouse PTPN6/SH-PTP1 Protein (aa 207-597, His & GST Tag)

Sign In for Pricing
View Details
trans-3'-Hydroxy Cotinine O-Beta-D-Glucuronide Ammonium Salt
TRC-H924575-1MG 1 mg

trans-3'-Hydroxy Cotinine O-Beta-D-Glucuronide Ammonium Salt

Sign In for Pricing
View Details