Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP51A1 Rabbit Polyclonal Antibody (HRP)

CYP51A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LDM, CP51, CYP51, CYPL1, P450L1, P450-14DM

UniProt

Q16850

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CYP51A1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000777

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 6- (hydroxymethyl) -2-naphthoate
OR1002243-01 100 mg

Methyl 6- (hydroxymethyl) -2-naphthoate

Sign In for Pricing
View Details
Methyl 6- (hydroxymethyl) -2-naphthoate
OR1002243-02 250 mg

Methyl 6- (hydroxymethyl) -2-naphthoate

Sign In for Pricing
View Details
Methyl 6- (hydroxymethyl) -2-naphthoate
OR1002243-03 1 g

Methyl 6- (hydroxymethyl) -2-naphthoate

Sign In for Pricing
View Details
Vav2 (VAV2, vav 2 oncogene, Oncogene VAV2, Guanine nucleotide exchange factor, Gef) (FITC) discontinued
V2121-10-FITC 100 µL

Vav2 (VAV2, vav 2 oncogene, Oncogene VAV2, Guanine nucleotide exchange factor, Gef) (FITC) discontinued

Sign In for Pricing
View Details
Tubulin Alpha 1A (TUBa1A) Magnetic Luminex Assay Kit
LKU603455 96 Tests

Tubulin Alpha 1A (TUBa1A) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
APC11 CRISPR/Cas9 KO Plasmid (h)
sc-405947 20 µg

APC11 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details