Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RND3 Rabbit Polyclonal Antibody (FITC)

RND3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ARHE, Rho8, RhoE, memB

UniProt

P61587

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RND3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005159

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFKP, CT (PFKP, PFKF, 6-phosphofructokinase type C, 6-phosphofructokinase, platelet type, Phosphofructo-1-kinase isozyme C, Phosphofructokinase 1, Phosphohexokinase) (Azide free) (HRP)
MBS6332896-01 0.2 mL

PFKP, CT (PFKP, PFKF, 6-phosphofructokinase type C, 6-phosphofructokinase, platelet type, Phosphofructo-1-kinase isozyme C, Phosphofructokinase 1, Phosphohexokinase) (Azide free) (HRP)

Sign In for Pricing
View Details
PFKP, CT (PFKP, PFKF, 6-phosphofructokinase type C, 6-phosphofructokinase, platelet type, Phosphofructo-1-kinase isozyme C, Phosphofructokinase 1, Phosphohexokinase) (Azide free) (HRP)
MBS6332896-02 5x 0.2 mL

PFKP, CT (PFKP, PFKF, 6-phosphofructokinase type C, 6-phosphofructokinase, platelet type, Phosphofructo-1-kinase isozyme C, Phosphofructokinase 1, Phosphohexokinase) (Azide free) (HRP)

Sign In for Pricing
View Details
Human Stomach Cancer HS0017
HS0017 6 Slides/Pack

Human Stomach Cancer HS0017

Sign In for Pricing
View Details
Bovine beta-galactosidase (betaGAL) ELISA Kit
OM620490 96 Strip Well

Bovine beta-galactosidase (betaGAL) ELISA Kit

Sign In for Pricing
View Details
Hydroxy ipronidazole
FH24022-01 25 mg

Hydroxy ipronidazole

Sign In for Pricing
View Details
Hydroxy ipronidazole
FH24022-02 50 mg

Hydroxy ipronidazole

Sign In for Pricing
View Details