Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RND3 Rabbit Polyclonal Antibody (HRP)

RND3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARHE, Rho8, RhoE, memB

UniProt

P61587

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RND3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005159

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM5A Conjugated Antibody
orb1611252 100 µL

KDM5A Conjugated Antibody

Sign In for Pricing
View Details
Human Myosin Binding Protein C, Slow Type (MYBPC1) ELISA Kit
YP-W17433-01 48 Tests

Human Myosin Binding Protein C, Slow Type (MYBPC1) ELISA Kit

Sign In for Pricing
View Details
Human Myosin Binding Protein C, Slow Type (MYBPC1) ELISA Kit
YP-W17433-02 96 Tests

Human Myosin Binding Protein C, Slow Type (MYBPC1) ELISA Kit

Sign In for Pricing
View Details
Pig Prostaglandin E2 (PGE2) ELISA Kit
abx257848-01 0.5 mg

Pig Prostaglandin E2 (PGE2) ELISA Kit

Sign In for Pricing
View Details
Pig Prostaglandin E2 (PGE2) ELISA Kit
abx257848-02 1 mg

Pig Prostaglandin E2 (PGE2) ELISA Kit

Sign In for Pricing
View Details
Pig Prostaglandin E2 (PGE2) ELISA Kit
abx257848-03 96 Tests

Pig Prostaglandin E2 (PGE2) ELISA Kit

Sign In for Pricing
View Details