Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ART1 Rabbit Polyclonal Antibody (HRP)

ART1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RT6, ART2, ARTC1, CD296

UniProt

P52961

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ART1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KHSTYNCEYIKDKKCKSGPCHLDNSAMGQSPLSAVWSLLLLLWFLVVRAF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004305

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SDS3 (SUDS3) activation kit by CRISPRa
GA112076 1 Kit

Human SDS3 (SUDS3) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS709896 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
Recombinant Intestinal Alkaline Phosphatase Antibody
RC-15753-01 50 μL

Recombinant Intestinal Alkaline Phosphatase Antibody

Sign In for Pricing
View Details
Recombinant Intestinal Alkaline Phosphatase Antibody
RC-15753-02 100 µL

Recombinant Intestinal Alkaline Phosphatase Antibody

Sign In for Pricing
View Details
Recombinant Intestinal Alkaline Phosphatase Antibody
RC-15753-03 1 mL

Recombinant Intestinal Alkaline Phosphatase Antibody

Sign In for Pricing
View Details
Fenspiride N-Oxide
TRC-F265010-250MG 250 mg

Fenspiride N-Oxide

Sign In for Pricing
View Details