Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP1A2 Rabbit Polyclonal Antibody (Biotin)

ATP1A2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FHM2, MHP2

UniProt

P50993

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence ISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTY

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

112 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

NCBI Accession Number

NP_000693

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF1A Recombinant Rabbit mAb
BS46090-01 50 µL

EIF1A Recombinant Rabbit mAb

Sign In for Pricing
View Details
EIF1A Recombinant Rabbit mAb
BS46090-02 100 µL

EIF1A Recombinant Rabbit mAb

Sign In for Pricing
View Details
Lentiviral human C10orf62 shRNA (UAS) - Lentiviral human C10orf62 shRNA (UAS) plasmid
GTR15150031 1 Vial

Lentiviral human C10orf62 shRNA (UAS) - Lentiviral human C10orf62 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Paper filter disc diam.90mm air monitoring glass fiber 75 g/m2 GVS 50 pc
FP090DAM75GLFL01 50 Pieces/Case:50 Pieces/ PACKS:1 PACKS/CASE

Paper filter disc diam.90mm air monitoring glass fiber 75 g/m2 GVS 50 pc

Sign In for Pricing
View Details
Mouse Human CD123 (FITC)
MBS8559284-01 0.1 mL

Mouse Human CD123 (FITC)

Sign In for Pricing
View Details
Mouse Human CD123 (FITC)
MBS8559284-02 0.1 mL (AF405L)

Mouse Human CD123 (FITC)

Sign In for Pricing
View Details