Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBP Rabbit Polyclonal Antibody (HRP)

OSBP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OSBP1

UniProt

P22059

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OSBP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALTLNAWESGTAPTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLSRKK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_002547

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM13C1 Double Nickase Plasmid (h2)
sc-408070-NIC-2 20 µg

FAM13C1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
CrkRS, NT (Cell Division Protein Kinase 12, Cell Division Cycle 2-related Protein Kinase 7, CDC2-related Protein Kinase 7, Cdc2-related Kinase, Arginine/Serine-rich, CDK12, CRK7, CRKRS, KIAA0904) (PE) discontinued
C2549-52A-PE 200 µL

CrkRS, NT (Cell Division Protein Kinase 12, Cell Division Cycle 2-related Protein Kinase 7, CDC2-related Protein Kinase 7, Cdc2-related Kinase, Arginine/Serine-rich, CDK12, CRK7, CRKRS, KIAA0904) (PE) discontinued

Sign In for Pricing
View Details
Recombinant Ralstonia metallidurans Homoserine kinase (thrB)
MBS1311472-01 0.02 mg (E-Coli)

Recombinant Ralstonia metallidurans Homoserine kinase (thrB)

Sign In for Pricing
View Details
Recombinant Ralstonia metallidurans Homoserine kinase (thrB)
MBS1311472-02 0.02 mg (Yeast)

Recombinant Ralstonia metallidurans Homoserine kinase (thrB)

Sign In for Pricing
View Details
Recombinant Ralstonia metallidurans Homoserine kinase (thrB)
MBS1311472-03 0.1 mg (E-Coli)

Recombinant Ralstonia metallidurans Homoserine kinase (thrB)

Sign In for Pricing
View Details
Recombinant Ralstonia metallidurans Homoserine kinase (thrB)
MBS1311472-04 0.1 mg (Yeast)

Recombinant Ralstonia metallidurans Homoserine kinase (thrB)

Sign In for Pricing
View Details