Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAM Rabbit Polyclonal Antibody (HRP)

BCAM Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AU, LU, CD239, MSK19

UniProt

P50895

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human BCAM

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_005572

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAE39P sgRNA CRISPR Lentivector (Human) (Target 3)
K2485804 1.0 µg DNA

TRNAE39P sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human Osteoprotegerin Ligand, OPGL ELISA Kit
MBS9302362-01 48 Well

Human Osteoprotegerin Ligand, OPGL ELISA Kit

Sign In for Pricing
View Details
Human Osteoprotegerin Ligand, OPGL ELISA Kit
MBS9302362-02 96 Well

Human Osteoprotegerin Ligand, OPGL ELISA Kit

Sign In for Pricing
View Details
Human Osteoprotegerin Ligand, OPGL ELISA Kit
MBS9302362-03 5x 96 Well

Human Osteoprotegerin Ligand, OPGL ELISA Kit

Sign In for Pricing
View Details
Human Osteoprotegerin Ligand, OPGL ELISA Kit
MBS9302362-04 10x 96 Well

Human Osteoprotegerin Ligand, OPGL ELISA Kit

Sign In for Pricing
View Details
Recombinant Human SEZ6 Protein, N-His
MBS1578901-01 0.1 mg

Recombinant Human SEZ6 Protein, N-His

Sign In for Pricing
View Details