Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAM Rabbit Polyclonal Antibody (Biotin)

BCAM Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AU, LU, CD239, MSK19

UniProt

P50895

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human BCAM

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLT

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005572

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD14 sgRNA CRISPR Lentivector (Human) (Target 2)
K1127803 1.0 µg DNA

KCTD14 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
TRPM7, CT (Transient Receptor Potential Cation Channel Subfamily M Member 7, Long Transient Receptor Potential Channel 7, LTrpC-7, Channel-kinase 1, CHAK1, LTRPC7) (AP) discontinued
T8666-37V-AP 200 µL

TRPM7, CT (Transient Receptor Potential Cation Channel Subfamily M Member 7, Long Transient Receptor Potential Channel 7, LTrpC-7, Channel-kinase 1, CHAK1, LTRPC7) (AP) discontinued

Sign In for Pricing
View Details
Mouse Mst1 qPCR Primer Pair
QM03090S 200 Tests

Mouse Mst1 qPCR Primer Pair

Sign In for Pricing
View Details
Clathrin Heavy Chain Rabbit mAb Antibody
orb3014500 100 µL

Clathrin Heavy Chain Rabbit mAb Antibody

Sign In for Pricing
View Details
KIF22 Rabbit Polyclonal Antibody
TA334697 100 µL

KIF22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNX32 (NM_152760) Human Tagged ORF Clone
RG207251 10 µg

SNX32 (NM_152760) Human Tagged ORF Clone

Sign In for Pricing
View Details