Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFSD14B Rabbit Polyclonal Antibody (HRP)

MFSD14B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HIATL1

UniProt

Q5SR56

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HIATL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVQKHSNSSSGSLTNTPERGSDEDIEPLLQDSSIWELSSFEEPGNQCTEL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115947

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPHB4 (Ephrin Type-B Receptor 4, Hepatoma Transmembrane Kinase, Tyrosine-protein Kinase TYRO11, EPHB4, HTK, MYK1, TYRO11)
406419-01 50 µL

EPHB4 (Ephrin Type-B Receptor 4, Hepatoma Transmembrane Kinase, Tyrosine-protein Kinase TYRO11, EPHB4, HTK, MYK1, TYRO11)

Sign In for Pricing
View Details
EPHB4 (Ephrin Type-B Receptor 4, Hepatoma Transmembrane Kinase, Tyrosine-protein Kinase TYRO11, EPHB4, HTK, MYK1, TYRO11)
406419-02 100 µL

EPHB4 (Ephrin Type-B Receptor 4, Hepatoma Transmembrane Kinase, Tyrosine-protein Kinase TYRO11, EPHB4, HTK, MYK1, TYRO11)

Sign In for Pricing
View Details
Recombinant Human MAS1 Protein, N-GST & C-His
ARO-P17530-01 50 µg

Recombinant Human MAS1 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human MAS1 Protein, N-GST & C-His
ARO-P17530-02 100 µg

Recombinant Human MAS1 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human MAS1 Protein, N-GST & C-His
ARO-P17530-03 1 mg

Recombinant Human MAS1 Protein, N-GST & C-His

Sign In for Pricing
View Details
Leucine-rich repeat transmembrane neuronal protein 2 (LRRTM2) Rat ELISA Kit
E6465 96 Tests

Leucine-rich repeat transmembrane neuronal protein 2 (LRRTM2) Rat ELISA Kit

Sign In for Pricing
View Details