Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1F10 Rabbit Polyclonal Antibody (FITC)

IL1F10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

IL-38, FKSG75, IL1HY2, IL-1HY2, IL1-theta, FIL1-theta

UniProt

Q8WWZ1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IL1F10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEA

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115945

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTT Antibody
orb673712-01 50 µg

HTT Antibody

Sign In for Pricing
View Details
HTT Antibody
orb673712-02 100 µg

HTT Antibody

Sign In for Pricing
View Details
NHLRC2 Rabbit Polyclonal Antibody (BF488)
orb2377364 100 µL

NHLRC2 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Prelid3b Mouse shRNA Lentiviral Particle (Locus ID 66390)
TL503609V 500 µL Each

Prelid3b Mouse shRNA Lentiviral Particle (Locus ID 66390)

Sign In for Pricing
View Details
Myeloperoxidase, NT (MPO, Myeloperoxidase, 89kD myeloperoxidase, 84kD myeloperoxidase, Myeloperoxidase light chain, Myeloperoxidase heavy chain) (MaxLight 750)
MBS6323251-01 0.1 mL

Myeloperoxidase, NT (MPO, Myeloperoxidase, 89kD myeloperoxidase, 84kD myeloperoxidase, Myeloperoxidase light chain, Myeloperoxidase heavy chain) (MaxLight 750)

Sign In for Pricing
View Details
Myeloperoxidase, NT (MPO, Myeloperoxidase, 89kD myeloperoxidase, 84kD myeloperoxidase, Myeloperoxidase light chain, Myeloperoxidase heavy chain) (MaxLight 750)
MBS6323251-02 5x 0.1 mL

Myeloperoxidase, NT (MPO, Myeloperoxidase, 89kD myeloperoxidase, 84kD myeloperoxidase, Myeloperoxidase light chain, Myeloperoxidase heavy chain) (MaxLight 750)

Sign In for Pricing
View Details