Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1F10 Rabbit Polyclonal Antibody (HRP)

IL1F10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IL-38, FKSG75, IL1HY2, IL-1HY2, IL1-theta, FIL1-theta

UniProt

Q8WWZ1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IL1F10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEA

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115945

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKL3/NKIAMRE Rabbit Polyclonal Antibody (BF555)
orb2409038 100 µL

CDKL3/NKIAMRE Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Artemis rabbit pAb Antibody
orb770048-01 50 μL

Artemis rabbit pAb Antibody

Sign In for Pricing
View Details
Artemis rabbit pAb Antibody
orb770048-02 100 µL

Artemis rabbit pAb Antibody

Sign In for Pricing
View Details
Research Grade Anti-Human CD279/PDCD1/PD1 (MW11-h317)
HS870516-01 100 µg

Research Grade Anti-Human CD279/PDCD1/PD1 (MW11-h317)

Sign In for Pricing
View Details
Research Grade Anti-Human CD279/PDCD1/PD1 (MW11-h317)
HS870516-02 1 mg

Research Grade Anti-Human CD279/PDCD1/PD1 (MW11-h317)

Sign In for Pricing
View Details
HMGCL (Hydroxymethylglutaryl-CoA Lyase, Mitochondrial, 3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase-Like 1)
482832 100 µL

HMGCL (Hydroxymethylglutaryl-CoA Lyase, Mitochondrial, 3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase-Like 1)

Sign In for Pricing
View Details