Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOXL3 Rabbit Polyclonal Antibody (HRP)

LOXL3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LOXL

UniProt

P58215

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LOXL3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AASSGQKKQQQSKPQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115992

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPM7 Human Gene Knockout Kit (CRISPR)
KN418043 1 Kit

TRPM7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B4]
TA500482BM 100 µL

CD4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B4]

Sign In for Pricing
View Details
Recombinant SIV (isolate SIVmac251v31523ru28) envelope glycoprotein gp120 Protein (His Tag)
PKSV030256 100 µg

Recombinant SIV (isolate SIVmac251v31523ru28) envelope glycoprotein gp120 Protein (His Tag)

Sign In for Pricing
View Details
KCC2 (SLC12A5) Rabbit Polyclonal Antibody
TA368601 100 µL

KCC2 (SLC12A5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Factor I (CFI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B5]
TA806115AM 100 µL

Factor I (CFI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B5]

Sign In for Pricing
View Details
Histone H1 (Pan Nuclear Marker) (AE-4), Biotin conjugate, 0.1mg/mL
BNCB3325-100 1x 100 µL

Histone H1 (Pan Nuclear Marker) (AE-4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details