Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGOH Rabbit Polyclonal Antibody (Biotin)

MAGOH Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MAGOH1, MAGOHA

UniProt

P61326

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MAGOH

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002361

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Cytokine receptor-like factor 1 (CRLF1) ELISA Kit
MBS7238277-01 48 Well

Porcine Cytokine receptor-like factor 1 (CRLF1) ELISA Kit

Sign In for Pricing
View Details
Porcine Cytokine receptor-like factor 1 (CRLF1) ELISA Kit
MBS7238277-02 96 Well

Porcine Cytokine receptor-like factor 1 (CRLF1) ELISA Kit

Sign In for Pricing
View Details
Porcine Cytokine receptor-like factor 1 (CRLF1) ELISA Kit
MBS7238277-03 5x 96 Well

Porcine Cytokine receptor-like factor 1 (CRLF1) ELISA Kit

Sign In for Pricing
View Details
Porcine Cytokine receptor-like factor 1 (CRLF1) ELISA Kit
MBS7238277-04 10x 96 Well

Porcine Cytokine receptor-like factor 1 (CRLF1) ELISA Kit

Sign In for Pricing
View Details
CD10, CT (Atriopeptidase, CALLA, CD 10, Common Acute Lymphocytic Leukemia Antigen, Enkephalinase, EPN, gp100, Membrane Metalloendopeptidase, MME, Neprilysin, NEP, Neutral Endopeptidase 24.11, Pmel17) (Azide free) (HRP)
MBS6467977-01 0.2 mL

CD10, CT (Atriopeptidase, CALLA, CD 10, Common Acute Lymphocytic Leukemia Antigen, Enkephalinase, EPN, gp100, Membrane Metalloendopeptidase, MME, Neprilysin, NEP, Neutral Endopeptidase 24.11, Pmel17) (Azide free) (HRP)

Sign In for Pricing
View Details
CD10, CT (Atriopeptidase, CALLA, CD 10, Common Acute Lymphocytic Leukemia Antigen, Enkephalinase, EPN, gp100, Membrane Metalloendopeptidase, MME, Neprilysin, NEP, Neutral Endopeptidase 24.11, Pmel17) (Azide free) (HRP)
MBS6467977-02 5x 0.2 mL

CD10, CT (Atriopeptidase, CALLA, CD 10, Common Acute Lymphocytic Leukemia Antigen, Enkephalinase, EPN, gp100, Membrane Metalloendopeptidase, MME, Neprilysin, NEP, Neutral Endopeptidase 24.11, Pmel17) (Azide free) (HRP)

Sign In for Pricing
View Details