Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGOH Rabbit Polyclonal Antibody (HRP)

MAGOH Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MAGOH1, MAGOHA

UniProt

P61326

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MAGOH

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002361

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse STAB1 Protein, His Tag
orb1290958-01 10 µg

Mouse STAB1 Protein, His Tag

Sign In for Pricing
View Details
Mouse STAB1 Protein, His Tag
orb1290958-02 50 µg

Mouse STAB1 Protein, His Tag

Sign In for Pricing
View Details
Mouse STAB1 Protein, His Tag
orb1290958-03 100 µg

Mouse STAB1 Protein, His Tag

Sign In for Pricing
View Details
CD247 (T-cell Surface Glycoprotein CD3 zeta Chain, T-cell Receptor T3 zeta Chain, CD3Z, T3Z, TCRZ) APC
MBS6135743-01 0.1 mL

CD247 (T-cell Surface Glycoprotein CD3 zeta Chain, T-cell Receptor T3 zeta Chain, CD3Z, T3Z, TCRZ) APC

Sign In for Pricing
View Details
CD247 (T-cell Surface Glycoprotein CD3 zeta Chain, T-cell Receptor T3 zeta Chain, CD3Z, T3Z, TCRZ) APC
MBS6135743-02 5x 0.1 mL

CD247 (T-cell Surface Glycoprotein CD3 zeta Chain, T-cell Receptor T3 zeta Chain, CD3Z, T3Z, TCRZ) APC

Sign In for Pricing
View Details
MTA2 Peptide - N-terminal region
MBS3227707-01 0.1 mg

MTA2 Peptide - N-terminal region

Sign In for Pricing
View Details