Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAMTOR3 Rabbit Polyclonal Antibody (FITC)

LAMTOR3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MP1, MAPBP, MAPKSP1, PRO0633, MAP2K1IP1, Ragulator3

UniProt

Q9UHA4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LAMTOR3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_068805

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arcn1 3'UTR GFP Stable Cell Line
TU152011 1.0 mL

Arcn1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Horse G Protein Coupled Receptor, Family C, Group 5, Member A ELISA Kit
MBS060214-01 48 Well

Horse G Protein Coupled Receptor, Family C, Group 5, Member A ELISA Kit

Sign In for Pricing
View Details
Horse G Protein Coupled Receptor, Family C, Group 5, Member A ELISA Kit
MBS060214-02 96 Well

Horse G Protein Coupled Receptor, Family C, Group 5, Member A ELISA Kit

Sign In for Pricing
View Details
Horse G Protein Coupled Receptor, Family C, Group 5, Member A ELISA Kit
MBS060214-03 5x 96 Well

Horse G Protein Coupled Receptor, Family C, Group 5, Member A ELISA Kit

Sign In for Pricing
View Details
Horse G Protein Coupled Receptor, Family C, Group 5, Member A ELISA Kit
MBS060214-04 10x 96 Well

Horse G Protein Coupled Receptor, Family C, Group 5, Member A ELISA Kit

Sign In for Pricing
View Details
CARD 6 Polyclonal Antibody
MBS8521618-01 0.1 mg

CARD 6 Polyclonal Antibody

Sign In for Pricing
View Details